TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E9CB09|E9CB09_CAPO3 Uncharacterized protein OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_05210 PE=4 SV=1
MADTVPVNPATGGPAAQKKPFTLLGCGLSTLTLVTGVFVALLTILCGVITCIGIDGTCLAVGIYMVFFGVLLLGIEAPVL
FNFSNPTRKIGDFFRKFKHWHRAILIPILTIVIFFCIGVASVISIVLLLLLCMLHVFTALGPRGQDAPSNSTAVSAPSTR
GYKQQADLDEEEGGL