TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E9FYJ5|E9FYJ5_DAPPU Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_43071 PE=4 SV=1
MESTANTVSSPSKLLPRACHERVSAENEKDKCQEKSLVETSHFEFDEVDGLRGKANFNWLDVVCIVVSISSYLADLITDG
FMAATYFNLGHHWYFGFTLAFVAIPALTMSGLSTKWYIKDQNNQNFPPVSTCTWVFRIFCLIFFLSPVARYFRKEYNKMG
QCYARMAYEDADATFLRLFECFLESAPQLVLQLYIMAKNTLNFGTDPIAVTFQAASVVTSVVSLAWALTTYNRSLRFAQV
DKENIHLLGTCVLFLAHLFGIVARVIALTVFASVYGWFIWAVCLGHWILMAIWLWLQQTAACSTRTEEFFFCLILAIIHI
FTFFNVKPDRTRFRYAFYYTVCFFENTILMVLWWIKVADIAPPRPWFHFPALFGQIGSFVLSIALLAFYYKCLHPNLLLP
NVGICNKDGATLCLSDTHPPIINGVPSPRTSPARLGRLDIIQREDVHPEM