TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E9ICW6|E9ICW6_SOLIN Putative uncharacterized protein (Fragment) OS=Solenopsis invicta GN=SINV_02755 PE=4 SV=1
NSEKNYQGLVYTTFRTLGANARASYALRRIKKSNHNLFIGDMVSIPGDALSPPCKMRAYRVIFPILRRFCDFYEFLGETT
PNYNELQHSKQCTLKKKFSMNKYKKCEVNLLAGKMPRQEYSVNPVANTLCHRKSTRCMKIPLKSTEQIYLIFFIPTLISC
SIYIIHFAADLVVAIQHFKEENPLWGMSTLAIIYAPALMYFILTVSRPDWWMTEDDKVTKGVLGWFALQVCQFIGFVFFV
LYSLNRMINNYVYKWIHLYRYAGLIVLSVDAINLSGDERVKTLNVAAAPAAIELYFFLQAWFQAAPQAVFQTHLLFRQTS
VPRSYQSKDLRMIYLYNSYIQYHKCILFAVTVQVLCIIMSIIVIAIKTASFQRFESQRVNGRKLPWAMWLKKYCVEEFNN
IKEKAPLQDSSLPAKEQEDAMNAPSESTPLEENPAVAENEQEQQIQSHTALLNRQVSVTPPLPPKNAQVTPPPMPLRGIT
TVPSLPVPDAPAPPRPDSVYTEEEAARTATTPESNQRLIGGSTQSLKVPKRKYSEKGLEEDDPIGRLLSFIWWFFFILAR
VFTIAVAYEFYPTTVLTMMGVHYAVMLAYLFYYSKYYDVITIIVNLWLGLVYIFSLIEYRIKFKYADWWTLPYYIFVIAQ
NVALTLTWYVHADWTGFWYTYIFGGILGSLALCILSSGVYHAMFRPKKRRVYSS