TCDB is operated by the Saier Lab Bioinformatics Group
>EIN79901.1 hypothetical protein ECPA10_1512 [Escherichia coli PA10]
MFGNAFGVKKRRSDEAEKPFWISYADLMTAMMVLFLVVMVASLSSVTQRIQRAEQGEKARGQDISRLCERLELHARNVNK
NIVVDCHDNRISFGEAGRFAHNQFFLNAEGQKALQDVVPLVLEASNSEEGKKWFKQIVIEGFTDTDGSYLYNLHLSLQRS
EWVMCSLLDSRSPLQKNISAEQQLQIRKLFLAGGVSFNNAKESKEASRRVELRMQFFGLKDKRDKADEVDFPPVVNKEVC
QLVMPL