TCDB is operated by the Saier Lab Bioinformatics Group
>EKF49049.1 viral A-type inclusion protein repeat protein [Thermosipho africanus H17ap60334]
MPLMTLQNFLNLIIHSTFTKIYLLVEIVIFVYFIIRRNSYISKFKNPIDEMQIEEILNFASFWPNLFITLGILGTFAGII
LGISNLNFQNDTTLKNSINSLLSSMGTAFSSSILGILFSIISQWLNKKLILEIPKNSSNKILDELIGIRNDIKELNEIFS
RPLETISENAGQTVEKYTQKISEINESFSSNFNKNINIFSNTVSKISEEISNQLESIRQQSELIEKKGELIQKQSENLQN
FSEIIENSKNLFNEILNSQNNIVNKMNELIDLTNSIISNQENFEKLNKNVSNLIEKLEEFTTYFNTNINNFVNSISEINN
KVPNQMILNYKKAFEEIELFTKDFFSKLKDITVYLDDSIENFDNSLNEFNETLLKVKNEIHNSIELFSNSLISSLDNFYT
NNNNNFDKLQE