TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0Q2H8|F0Q2H8_ACIAP Uncharacterized protein OS=Acidovorax avenae (strain ATCC 19860 / DSM 7227 / JCM 20985 / NCPPB 1011) GN=Acav_3854 PE=4 SV=1
MATHQTPNPYAAAAAPPPRPRRRRALRITLWSFASLVALLLVLLAAAWWWTGTGNSLATALAQAARYLPAGQTLETRDVS
GSVRAGGQIGWLRWSSPTLVVEVQDARIGWSLPPLLQRELALGEVHAARIVATPRTPAEPEPDKPVQPLEQLVLPLRIDI
PLRVDEITWAAATPVTVRNLAGRYRFDGDQHSATLDNLELAQGRYSGSATLQAQAPMALQLTADGVVRTPAPGGGADIEA
TARAEVRGTLATAAARLDVSGRLQAVAAQAAAPQRPAASAPRRAGSAPRPPAAAASTPASASLPAGTALSSAEPMQAQVQ
ARIAPWAPQPLLQAQAQLQALDTAALWPQAPATRLSGRIEAAPAPATAAGTGAPPAAPQAAPAQAPASAASPSAPAPSAG
TPPATGWGLSAQLENALPGPWDKGRLPVESIDARADFDGTRWTVPQATARVGSGTIALEGAFTPATHALQGDLELRGVRP
DAVLSTLDAAPLSGRARARSDGAPATDTDAAPAPLVRFSADIRSAGTSRAPRKGGTATAQAAPPLRIDRLATEGTWQGTL
LTLAQLQLDALQVQASARQLRIDTAARSAQGQMQATLPGATAQVDGRIAPRAGAGTLDLRVADAQRVQRWIESVPGLGSA
LGGAALQGEARLDARWNGGWESLLGQLQAAGLVTRPRAGAATATGPFELQARLAAPRWEVALPPQPGTGSGPATIRLTAV
RADVAGSVPKATLSLDGEARLDERRLDLRLRGSGGAAGPDQWRAQIDELRLQARDGQRPGPWTVQFAQPLTVSARTAPTL
QVETSGGQARVSAPAPGDVTLRWEPVRFARTASGSLQLRTRGQLQGLPMAWAEALAQGSDALDRLGVQGNLVFDGDWDVD
AGDTLRASASLRRTSGDLRLLTGNAPAATVVRSSGPSAGTGTGSAAGMVRGTAAAANASATDTPRGAGTPAGVRAAELRL
QAEGDTVRARLQWDSERAGQVQAEASTRLARVGEGWEWPADAPLSATARARLPDVGVWSTLAPPGWRVQGTLDADVALSG
TRTAPRWSGTLAADQLAVRSLLDGVDLQNGRLRAALRGDRLEITEFRVNGGPGSSARIAGFSGNRTAAPKDGGTLSGTGT
VSWAGMGQEAAAGGSGIAMDFTADARALQVLVRADRQVSVSGQVRAQLRQGQLSLRGKLTADRATIILPEAGAPSLGSDV
VVRSAATDRARAEAAQREGAQAGRVEAARPPDIALTFDLGDDFALQGHGVTTRLAGELEIRGATTAGGPPRITGEVRTVE
GRYRAWGQALNIETGLARFNGPYDNPALDVLAIRPNISVRAGVQVSGTAKAPRVALYSDPDLPDAEKLSWVVLGRSTAAG
GAEAALLQQAALALLGGGGGNAGAGNFASRLGLDEIGFRGPNSGASSEDASGAALTFGKRLSKDLYVTYERSLSGALGTL
YIFYDLTQRLTLRGQTGVQSAVDLIYTLRYD