TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0S6A8|F0S6A8_PEDSD Uncharacterized protein OS=Pedobacter saltans (strain ATCC 51119 / DSM 12145 / JCM 21818 / LMG 10337 / NBRC 100064 / NCIMB 13643) GN=Pedsa_2680 PE=4 SV=1
MKRLFIALFAISGLALTANAQEFGFKQGNGFVEGNVGFHSSNDKNTDTKVNEFEITPKVGYFLTDKVAIGIQLGVSTSKN
ENSTTGYEKKVNDLGAGVFGRYYFLELGKRFKTYTEVGVGYATSKTETRPTTAANTNTVKSKVLGIGAGVGANYFLTEKI
ALNFALANVIGFTSEKPDGQKAQTNFGLSAGSINNIFDAAQFGLVFKF