TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F1QZ58|F1QZ58_DANRE Uncharacterized protein (Fragment) OS=Danio rerio GN=abch1 PE=3 SV=1
SLESGTMKTDLEAGSFSAAIHCHDVCRSYGKLKVLNNLNLTLPQGQIYGLLGPSGCGKTTLLKCIVGTLKISRGHITVLG
KPPAFPGHEVPGKMVGYMPQDIALYNEFTISNTLWFFGRIHGLSSKETEARMSFLIDFLDLPQKHSLVKNLSGGQRRRVS
LGAALLQNPKLLILDEPTVGVDPVLRAKIWQHLVEIVRGGQVSIIITTHYIEEARQANTVGLMRNGRLLAEGPPDAVMKQ
HNAATLETAFLQLCEDSDQSGPKQSPQGRLLDSSPSPDSMRDEIREPILRKSTSEDMPKCKADWKVRARHIIPKWSNIAA
LMIKTMVRMRRLPGSLCFQFLLPVIQICLMCLCIGGDPKNIDVAVVNNESSPSAFSRSLLSFLDNTSINQIGERFPFCFL
QVSLSHSDAFDGIRNGEYWGVIEFGENFTSYLTKRMLQPRVSREVVEGGSVHAWLDLTNRQIALMLQKKLHQAFEAFMEK
RLGSMSYMVAVPIKFEEPIYGSKNTDFTTFVTPGAVLSITFYLAVGLTALSFVLERKEGLLDRCWVAGVSSLETMLAHLF
SQLFVISVQIILLLIFTLLVFNIPNEGSLALVISLIVLQGVTGISFGLVISSAIDDEQSANQAALGVFYPNLILSGVIWP
VECIPYPLRYLSLVLPQTYASEALRCIMYRGWGLSRMMVWRGFAVTLGWNTFFLMLATIILKLRT