TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F1XYT9|F1XYT9_ECO57 O-antigen flippase Wzx OS=Escherichia coli O157:H7 str. 1125 GN=ECF_00257 PE=4 SV=1
MIMNKIKKILKFCTLKKYDTSSALGREQERYRIISLSVISSLISKILSLLSLILTVSLTLPYLGQERFGVWMTITSLGAA
LTFLDLGIGNALTNRIAHSFACGKNLKMSRQISGGLTLLAGLSFVITAICYITSGMIDWQLVIKGINENVYAELQHSIKV
FVIIFGLGIYSNGVQKVYMGIQKAYISNIVNAIFILLSIITLVISSKLHAGLPVLIVSTLGIQYISGIYLTINLIIKRLI
KFTKVNIHAKREAPYLILNGFFFFILQLGTLATWSGDNFIISITLGVTYVAVFSITQRLFQISTVPLTIYNIPLWAAYAD
AHARNDTQFIKKTLRTSLKIVGISSFLLAFILVVFGSEVVNIWTEGKIQVPRTFIIAYALWSVIDAFSNTFASFLNGLNI
VKQQMLAVVTLILIAIPAKYIIVSHFGLTVMLYCFIFIYIVNYFIWYKCSFKKHIDRQLNIRG