TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F4JEW3|F4JEW3_ARATH Uncharacterized protein OS=Arabidopsis thaliana GN=At3g27030 PE=4 SV=1
MPDWGPVFVAVTLFVLLTPGLLIQVPGRGRVVEFGTFQTSGLSVIVHTLIYFTLVCILLLALQIHICNLFSTSMADWAPV
LVGVVLFVILSPGLLFSLPGNNRTVDFGGLKTNGKAIAVHTLIFFAIYTILILALNLHIYTG