TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F6WQA0|F6WQA0_CIOIN XK-related protein OS=Ciona intestinalis GN=LOC100183252 PE=3 SV=2
MSKRKPKCCYFPEIPTRWLLFIEFAFMFGTTVIYFADIVTDIITLRMYYMREWYYAFGLSICFIVLPSILMAVLEYNFLK
KAYGKSVPWKMIVLRTALNIPFQLTIIWYHCQLSYNYLRNWLDHIRGVGKNDRRTAAEWYEPTTLERSRGASLSSLNDID
NYCRNDDKNISEQGSHLVSNTNLSRSMGSLAPVSVEQEKPGKSNWWKRLTREQWLAHLNKLKLSESMLESLPQLLINLYL
IAYYQETHVIQYISAVLSYISLCGGVVRYDKTRKDNEADQWMVDRTLLHSRAFNTRLEWPQLLFITIYKGSFLAARILAF
VFFTIFFSWYIFIPIVIHWCVFLCYHIFQWYPDFSKVSRQLQQADYKYRAYIFLSHDFMSVFHASLMCIFIHVRPYYHAF
LDQPYCFMFWFYLVYVTENVFLFLIPGIVLNLQEKDESLNFYQYYVLLSTELILNIMGCIFCSTYYLAVHKMRTYTAHAY
PAASKILCCCCYDNKDMVEEWLPVRPEWTVCKQAETSEIFFLTKEQLKSFQEVYNTVVRNDRNKGRAVECFIDDRCKIFY
APRSKLRKVSTSQAQPFLVKLNSASNLSRPKPHVPQVDVIVEEETHLKEYNETSVIIHSEEIDAVQTEIPQREYAEPTEE
YLKDKPKAKPRSKSMKSGRVSPVRPPR