TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F6XSK1|F6XSK1_CIOIN Uncharacterized protein OS=Ciona intestinalis GN=LOC100176892 PE=3 SV=1
MAHENVTFEPETGVVMTSFTTVHQNMTSFNNGDETNGKPYKERYLEEALAYENTEAIDENEMELANRRDEEVSIQSRNGK
GSQDVAQVRVKDPPPTPPQWQLYMHIAFFAMCGCLCRIGTDKIFGTLAVIENSGEVVNLSFISNMVGSFVLGALNASPMG
STRLGAMYKGLTTGFCGSYTTWSKWNQQLSLALVGETNTVSQSQVLSIVSWFIGFHSFIGSYCVGLDFGKDVGGRIGKKV
SPNGPKISNIAVAVLLFSAAAGFIVGVIVDPTQTGKSIWMAVLFAPFGACIRAYLAKYKYERFMLPLGTLLANLLGALVL
AAIHVINVRAVTCGSGTICWGSVVTYGIGTGFCACLTTVSTFMSEIYKLRPANPKFAYGYAILTVVICQVLCGIINGINY
NYDTY