TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F7YV77|F7YV77_9THEM Putative uncharacterized protein OS=Thermotoga thermarum DSM 5069 GN=Theth_0277 PE=4 SV=1
MTSAIKKMIKVIILLGLIEIGLFLVFFGGKAAICVILGLFASLVNLLLLWRDVRKCVVKRKPMLVSGYLIRYTISGVTLA
LASLISIPGVFGAFVGLMNEKFAAFLSWR