TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F8AM98|F8AM98_METOI Uncharacterized protein OS=Methanothermococcus okinawensis (strain DSM 14208 / JCM 11175 / IH1) GN=Metok_0811 PE=4 SV=1
MSSVNSIQLAYEFVLYIIMGFIIGYFLSNYYNNNIFIVIGFLFGVLMAFLRVIKLIKDRN