TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F8C3M1|F8C3M1_THEGP Uncharacterized protein OS=Thermodesulfobacterium geofontis (strain OPB45) GN=TOPB45_0364 PE=4 SV=1
MLLVSKIVLAIFISFIIVSNSFAEEYLPIDDEAYFFLQRLEAEGIIQSGLLSTKPLSRKEIARLIKEAEENSKDKSLYIK
SIVKKLKERFNEEFRKVDFIKPVDSIYTKYFYQDINLQSLNYNNDGDKLEKGSNLRIGFETRAKLDNISYYLNPELRTSD
SKDCLIIKRGYLVLGFDGIDIRVGKDSQWWGPGVHGSILLSNNAPPFTMINITNPMPTLLPSFLKYLGPFKFNFFVTRLE
EDRDIPEPYLWGLRINFKPTPYTEISFERTALLGGKGRSESLRTWFYSFTGKGENVAGVEAGDQRAGGDIKITIPWKRQP
FQAYFSADGEDEAGGLPYKWAYLYGIYLPRIGNIEELSLRLEYAKTSPVWYIHHIYTSGYTYKGWIIGHHMGRDSNDLYL
ELTYLSPDIGKFSIFYDREKYNITNSKKTEVGLNFSVRIKKFDFNLKYTKARFEEIPVKNGELLNFGIKYNF