TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F8FLY5|F8FLY5_PAEMK Putative uncharacterized protein OS=Paenibacillus mucilaginosus (strain KNP414) GN=KNP414_06380 PE=4 SV=1
MDRFSKNSLLLWMVYMLLALIILFMLQQLRPLFVGIYQFLREILTPFIIAMIISYVLNPVVTLLGARKVPRTIAVLLIYA
VFITSTTVVLMNVIPMFVRQLAELNEHMPDVAYKAQSVVQNMNELQFLPDSVRTGINQSLSKLENGISLAIANYINSIGS
TINTLFLIFIIPFVAFYILKDFQLLEKTTLAIVPRNHRKEIVSMLMDIDTALGNYIRGQFTVCMIVGLLAYIGYWLIGMP
YALLLACVVAVFNIIPYLGPFLGAAPALIVAATISVKMVLFVILVNTACQIMEGNVISPQVVGRSLKMHPLFIIFALLVG
GEIAGIAGLILAVPFFAVMKVILQHVFSYYIHRRTPT