TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0CA41|G0CA41_XANCA O-Antigen Polymerase family OS=Xanthomonas campestris pv. raphani 756C GN=XCR_0562 PE=4 SV=1
MAELGVFVLTALVVNMPSGLLPFGVCLLGGTLLGWRSLRVGLATQGWSLRVLTGLTAVVIAMSVLSIVLFEPSVRDVENR
SRFLVLPWAALWAYALQPRQVWLWRGALAGVFAAMLVAILQVMNGAERAEGWTNAIVFADIALMLLVVAIFCRPNGQVRW
LLGAAVAAVAVIVLSGSRGVWLSLLVTLGVLVWGAPWQSARMRLLAFVGGAVVCVGLVLSVPGLTEQLRIGELQSDFQRY
EVGDADSSAGARIERLHVAWDTLQAHPLTGVGVGRFDDAMRELPLCAGDTWLLRCHLGHAHNDLAEWGATQGIPGLLLLI
AVYGVPLWMFVRLHRRSGQRQFRGPAAAGVMIVISYALCGLTQSMFAHQVSASFYAAMVGILAGLAARQAQQHATAASPV
AQSAR