TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0CNV6|G0CNV6_CORUL Putative uncharacterized protein OS=Corynebacterium ulcerans 809 GN=CULC809_01882 PE=4 SV=1
MEHMENWVQLSTTGVVKEIFDFMVSLAKLGGNVASMIKIFK