TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0JXK9|G0JXK9_STEMA Lipid A biosynthesis domain protein OS=Stenotrophomonas maltophilia JV3 GN=BurJV3_4005 PE=4 SV=1
MGLELHWLDQPLTWLYWTGLHVTGWKLIGYTGALMFGGRWLVQFIASKRAGKPVIPRLFWYMSVIGSLMTLSYFLFSAKQ
DSVGVLQNLFPAFTALYSLHLDIKHRGWKRDKASH