TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0QX98|G0QX98_ICHMG Putative uncharacterized protein OS=Ichthyophthirius multifiliis (strain G5) GN=IMG5_139910 PE=4 SV=1
MQNKQMETNSPHFIRVFIKNLLKIIIYYSQIVFDIISLTLLFQNEIYIHSIVLAIIIAFSYFYKFLYHYKLEYGRWIIKL
LFEIFYISQILRCFFPEFYQISEKQFQKLQGIQQSGPSLFILIHVIFYLDFSHLYLWISIGVSFLNLYYSNLIYFLLLNN
DFENSKEQIKTQFYVILFSQYSSRICLWAVFCYILKPISVWTTIGCDFLCCILIYIFKIYEKQTNLLCFYDYMFCFRFYE
LQFFTYEGYEKSKRYYNLKEFYRFIVQLTQIIIIILYYSKFGIIYQYMDVKYVLEDYYFIIFIGGVIFFIFNQSQNFSRI
LYVQQSESQTIQNYKNRIRTQQNQIEKLQFEINKVQPELSKQQEEILKSTKNQVSQQQYLEDLQNSVQTKGQEIENLKKK
IEEQNNLVDLVNDGNLKQEKIILKFKEDNIQLQNFIEKLQKDLEKAKMDINQLQAVNIQQKNIIKDLNYKNEKILQDLQF
MNNSEEFPITIAKNLENQLKSLKEQNENSEKRFNNLYSQYQKKENELKESLYRQALNDININNNQSFNIRMKNENDFLQQ
KISQKDELLIKQKNDIIDLFQKNEELQKKIKSYEKQIHKIQRFDEEIYKQQQYTNLNLKVLESQSVIIQKQPDIQYLNEN
IKKIVFHQFIDQEISQNILKQIKFPYFLKFKYDKSCQKFNQIIYIFVNGFLFIYQKNSWSNTNFNTYQIISKIIQQCKSL
LVLEVNIEKYLIMYFQIYK