TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G2HQN2|G2HQN2_9PROT Putative uncharacterized protein OS=Arcobacter butzleri ED-1 GN=ABED_1938 PE=4 SV=1
MIFINKISGLLIFFSFITTIYAYFFQNDFLIVAGVLAWLSSALLFFTLKHKKILLILLSLSFFAFLFSYINDFRIDFIKA
FTVNQYLLTLLIAVGFLKLIATPKKEKNHLLPKGKQSFIKTYLSVHLFGSVINISSLLLVADKMYKKSPLNPAQIVLLTR
AFASDAYWSPFFVAFAAAITYAPNLQTYTIISFGIFLAITAFMITYFDVTKDKKFNIEEFNGYPLSLETLYLPIILAIFV
LTTHYFYPTLEVIVLISSFSILMTFFILPLKKNFSEALKILKYHILNELPKMKSEISLFLVAGLFGILIGSVLTGLNFTL
PFEVFDYEIASLLLLIFILLAFIGIHPIITIAIIGDFFIHSNHTLLAMTFLMAWSTTVSTSPISGLNLTIVARYNCSAKE
IFMLNIFYALKMYIVCVICLFVLSKYLNI