TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G2I0S0|G2I0S0_GLUXN Lipopolysaccharide biogenesis periplasmic protein OS=Gluconacetobacter xylinus (strain NBRC 3288 / BCRC 11682 / LMG 1693) GN=GLX_21160 PE=4 SV=1
MPQPAKPDSPPRRNLLAQIRFPFLGVLVVGVLALVIFWSWDWFIPMVERRAGAALGRKVTLAHLHVHVGRVIRITADEVK
IDEPEGFATLPPFATADHLMVGVRLWPLLGGKLDLPVIALDKPVVELNEKRDGTANYQFPASGGGGSTAMPRIGELNIDA
GQLHLVHAGLRSNMRAEVHTTPGQGDVQPRIVADVRGTYTGQAIIGHFSGGALVSLADRTRPYPVDVDVRHGPTRLTLVG
TVDDPLSFAGTRLRLTLAGPDMSLLYPLTGVVIPQTPAYHVAGSLDYHDGRVRFRNFEGVVGSSDLGGTLDVDPHQSVTF
VDTNLHSRHVDLADLGGFFGATPGEHPSTTQQAAQEKVHQASGAVLPSTPINMPRLKATNVHLAYHGDHIENRHTPLDNI
DVLADIRDGTIDVHHLNFAVGKGTLASSGTFVPQGNGMDARIRIDMEQIDLARLMQAMGHNLHGQGIIGGHIVVHGHGQS
LAQIVGNGDGGITMALDDGGDISAILPDLLGLELGKALLSALGLPARTDLKCLIADMPLQDGVFHTRTMLLETGDTRTVG
SGDIRFSNNTIDYKLLTHSRHFAIASFPGPLYITGPLKSPNVRPGAEIIGRAVASVLTGFVFSPVGLLPTIEGGVGKNSS
CASAIREVNDNPAAGIAPHASHPGRHGAHGHGVSARQGAAASKAGASNIGPNGLSAAERARIRAVWAGKMATH