TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G2JSZ8|G2JSZ8_LISMN Competence protein ComFC OS=Listeria monocytogenes J0161 GN=LMOG_02351 PE=4 SV=1
MTNCLLCFQPVRQSASWEISWLFEPLPICCNLCLAGFEKLTGLLCKNCSKESLDDVCEDCQSRTHFLDSNKSIYRYNDFA
KEYMKKFKFQGDYEIGAIFKKELSTFLSEKKEKIVPIPVSETRKLERGFNQTTAILKQSGILYEELLAKKHTEKQSKKTK
RERLASEQAFYFSGKEILKSTEVILFDDIYTTGSTLNLAAQILKEAGVHKVSALTIFR