TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G3XD19|G3XD19_PSEAE O-antigen translocase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wzx PE=4 SV=1
MSAAFINRVARVLVGTLGAQLITIGVTLLLVRLYSPAEMGAFSVWLSFATIFAVVVTGRYELAIFSTREEGELQAIVKLI
LQLTLLIFVAVAIAVVIGRHLIESMPVVIGEYWFALAVASLGLGINKLVLSLLTFQQSFNRLGVARVSLAACIAVAQVSA
AYLLEGVSGLIYGQLFGVVVATALAALWVGKSLILNCIETPWRMVRQVAVQYINFPKFSLPADLVNTVASQVPVILLAAK
FGGDSAGWFALTLKIMGAPISLLAASVLDVFKEQAARDYREFGNCRGIFLKTFRLLAVLALPPFIIFWFIGEWAFGLVFG
EAWAESGRYAVLMVPLFYMRFVVSPLSYTIYIAQRQSMDLLWQLALLLLTFICFTLPDSVDSVLWFYSIAYAVMYFVYFW
MSFQCAKGDAK