TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G3XN47|G3XN47_ASPNA Uncharacterized protein OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) GN=ASPNIDRAFT_53845 PE=4 SV=1
MAEKANPPAVPAYEEQPAETHELSSSREVPAYTQPPAGQTPEIQPHQPQQTFYAGSQHPSGYNTPTPLYALQKTPAPVDC
PACGERKMTRVEAETGSSTHAWAAVLCCCLCLGCIPYMMSSLKNQCHYCGGCGALLATWHNSGRTDVHRSGAK