TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G3XZI4|G3XZI4_ASPNA Putative uncharacterized protein OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) GN=ASPNIDRAFT_199857 PE=4 SV=1
MGKGGRIVCIFTPYVLTIASLICIIMVGLGCTKSSSSTLNDLYFFRADLKNITSEASSTASTVSSVVSDLTGVSDGDLSA
ALEEIEEQYNIEDFYAIGLWGYCEGNITSNNSYQTNNCSKPEAEFWFNPLEVWNLEESGLENALPSKVKSSLNTYKAVSK
WMFIAYIIAFALTVAELVVGVFAICSRWGSCVTSLVSAVAFFFTAAASVTSTAMFAVLKGVFKSELEQYGIKGQMGKNIY
VATWLAVAFSLAATLFWIISSCCCSGRSPYNHRNRNRAVMAEKTPYTYEALGPYGQPQQTPYNTSYPPPPPIHGNQTTGR
TNAYEPFRHT