TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G4TKM5|G4TKM5_PIRID Uncharacterized protein OS=Piriformospora indica (strain DSM 11827) GN=PIIN_05803 PE=4 SV=1
MAGLARALQWISLLILLHAAYSTFDYLSQLKAVDRPQDHIPKDVTLEALLSLFLFVLGTVLASPTLAEITWAKEMDKRSI
DEMDSRIGFMDLKHRGAVFFGSQ