TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G5ED30|G5ED30_CAEEL Cell junction protein VAB-9 OS=Caenorhabditis elegans GN=vab-9 PE=2 SV=1
MVAVQRTTIEAVSAVRPLKIISLICLVIAVGLMIVALCSTSWLKTGSFRTGLFKECTSTNEPTHAAPFPGAPAPGSCHKP
SRNSGFLTAAAVLLIVALFLTALSTIFNIVGLSKSDVRGKYRWYRIATMISGFSVLLELTALIMFPAAFYVKISDYGSRR
NWEVDWSYGIAWGATLFTIGATIMLICDKEHEEVYYKEKTIYNPPPELSDR