TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G5EEE2|G5EEE2_CAEEL Protein TAX-2 OS=Caenorhabditis elegans GN=tax-2 PE=4 SV=1
MYQVPKRAKTNLAREIRKREFSYVDRQKASKPTQLSEKEWKSPRSEDSFDLLDPANASKEPSASTRPLPYPPTRPPEVVI
QIDEVESPILGLIDETDDHELDGRLDPASSFDANSLSATRASSIIEDDVRSQISFIMRERLHSIAKEVHRRTSAVREDLI
RETPEDTVSMASNVPKQNEHRPSLMSLIGLQNRSESPTVDTVKNCFGFSLKGTFHPYGRFYMTWLSLVTLCFLFNAFCIP
LRSSYPYQTADNWMYWFIVDYSCDLVYVIDMLLIKPRLRFTRGGIQVKIYKDTQRHYLMTRTFKLDILSILPTDLMYFFF
GKMPIWRINRVLKINSFWLLFDMLDNSFANPYAIRIARTLSYMIYIIHCNSCVYYKLSALQAFGQIAYLENGKWYLNKWV
YNNQGNAYIRCFYFTAAVATSTGNNPAPTNVIEYIYMTCSWMMGVFVFALLLGQIRDIVSNANRNREEFQRKMDLALGEC
KKLGLKMETTNRVRDWFIYTWQQQKTLDEKKLIEKLPLKLQTDLALSVHYTTLSKVQLFQDCDRALLRDLVLKLRPVIFL
PGDMICLKGDVGKEMYIINQGILQVVGGDHNEKIFAELAQGAVFGEISLLAIGGNNRRTASIRAKGYCTLFVLAKEDLND
VIRYYPQAQTILRRKAAAMLKNDKKSDEKTEKIKAQAELEDRCKINPRQVPKLITLIANMTEMNENKGVQELKKVIEEET
EKSRRQSIYYPWSTLQRDDDDEEEWNDEEDLSDVGEDFDLDPTNHSDDEDPMEDVDLAPEVHDDDWDQPGTSGTQKLHAD