TCDB is operated by the Saier Lab Bioinformatics Group
>sp|G5EGL9|AFF1_CAEEL Cell fusion protein aff-1 OS=Caenorhabditis elegans GN=aff-1 PE=2 SV=1
MRLWQWSIAVAICLVMVTEARLRRHHRKRRFVSSNFDEFYCGESAHAQSQFEEERESNSSKVSSVHSTQFNWGLDNTICI
KLQNVVHVLKYERLEQRYPIENSYTFSVPLIDTNCKCHCYGFGTNDVCNVEKYADDRNCTTSSEFPTCYTKYHPAVEPLD
CPVTSIPAKACCDIKLKPRDGRMFRAVKLQQPINDMIISHSIFANNSGKMMKVLGPDEFRINLLKGKEQFELTEYHRISV
QLVASSPQQQLREGMYYFPEENHNDLREGKINEITESDLDKLGWYRRVGNDWQVATSGLLLRNAHKVVIKNCKGQVHMDQ
FSGTKNFVLRGTQYNDTYNERRVSDNNFVRSVKVDESSREITIVHEHGTAAQVSLKTDTRPNLTKSQSLLANFTGSITLD
HDGNRMLNVTFFGVKGTVHIKMYVNDRKLIATFACTAQFGTSLKDDGSRISLPSTINQAQWVCILPDEQPTKSEICKWIP
YEEKAMRTPRQEQSWSKGHSPCSQAECNSLKSGVSDLFPWIMNFDYFMAHGGDFTEWLKIGIHIVIAVGLLLLLILLFTK
CLVPLACCSLSIPFKNRNKKKKKKNSSDY