TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G5LV43|G5LV43_SALET Uncharacterized protein YhjG OS=Salmonella enterica subsp. enterica serovar Alachua str. R6-377 GN=LTSEALA_5126 PE=4 SV=1
MILLIATFDWNRLKPTINQKVSTELNRPFAIRGDLGVVWERQKQETGWRSWVPWPHVHAEDIILGNPPDIPEVTMVHLPR
VEATLAPLALLTKTVWLPWIKLVKPDARLIRLSEKTNNWTFNLTQDKNTDPNAKPSAWSFRLDNILFDQGRIAIDDKVSK
ADITILVDPLGKPLPFSEVTGTKGKADKSTVGDYVFGLKAQGRYNGEPLTGTGKIGGMLALRSESTPFPVQADFRSGNTR
VAFSGVVNEPMKMGGVDLRLKFSGDSLGDLYDLTGVLLPDTPPFETDGRLVAKIDAEKSSVFDYRGFNGRIGDSDIHGSL
TYTTGKPRPKLEGDVESRQLRLADLGPLIGVDSGKDAEQSKRSEQRKGEKNVQPADKVLPYDRFETDKWDVMDADVRFKG
RRIEHGGSLPISDLSTHIILKNADLRLQPLKFGLAGGSIVSNIHLEGDKKPMQGRADIQARRLKLKELMPDVELMQKTLG
ELNGDADIRGTGNSVAALLGNSNGNLKLLMNDGLISRNLMEIVGLNVGNYIVGQIFGDDEVRVNCAAANLNIANGVARPQ
IFAFDTENALINVTGTASFASEQLDLTIDPESKGIRIITLRSPLYVRGTFKNPQAGVKPGPLIARGAVAAGPLIARGAAA
ALATLVTPAAALLALISPSEGEANQCRTILTQMKQ