TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G7DG36|G7DG36_BRAJP Uncharacterized protein OS=Bradyrhizobium japonicum USDA 6 GN=BJ6T_55550 PE=4 SV=1
MDQRTSGADALIQKNDAAPALLGVVCGLSAALFWALGFAGTRHGLKVGFTPVDLLVHRYVWSGIAFLPLVARAGIGDLCG
IGWGRGLVLMVLGGPVMSLISYTGFLFVPLGHGSVIQPSCATLGGLLLAAVVLKEHISASRLAGALVIVGGLCVIGAESI
GHIGSDGVFGDLIFVLTGFMFAGFGALLRRWRVSAVSAALVINVLSLLLLPIYLATVGLAHVAAIGVTENAIQALAQGVL
AGPAALYLFAVSVQRLGVARAAVIPACVPALTLLVGWLLLGEPPTMLQVAGLATVLCGFYLAQRQR