TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G7JLA3|G7JLA3_MEDTR Fruit weight 2.2 protein OS=Medicago truncatula OX=3880 GN=11444523 PE=4 SV=2
MNSTNNIMYPAVSETDHSSHGHGHPPQGQGYVLQMPSYGMPVQQPYAPPYISTSSRGIPRTHHWSTGLCRCLDDPGICLV
TCFCPCVTFGLIAEIVDKGNSTCTCDGTIYGALLAVTGLACLYSCYYRSKLRAQYDLPEAPCMDCLVHFCCETCALCQEY
RELKNRGYDLSIGWDANVERQRPGVAVAPPMISPMTR