TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G7U9U2|G7U9U2_PROAA Putative uncharacterized protein OS=Propionibacterium acnes ATCC 11828 GN=TIIST44_11145 PE=4 SV=1
MTSTDPHDYRDDIRHDREFVNDTEAVIRLGSMLLSSGTGSYRVKRAMSDAGLALGIDRLDASVSLTEITATAHRGDNFRT
VAREVYRVRVDSSRIAALEDLAHNLPAGTTGRELESRLDDISRTVRPKWAEWQTVLAGGVACAGFAILNKFSLADSLVVL
AAASVGQFVRGRLNRRWLNQFGIAALASAAACLIYLMLSDLLTNTGLHTIHGPGYVASLLFLVPGFPMITSILDMVRMDF
TAGLSRATYSVGLILAATMSAWVFSAATGLQPLPAQTVFPYPWAWFAYAVATACGVAGFAILFNSSPCTVAWAAALGACG
NLCRLALVGVNLPAQLAAGVGGIVIGFLASPLSVRTKLPRITLTVPACVIMVPGASMYRTVYWLNGQDMTKALTFGVDAV
LTVILIACGLAVARMCTDPAWARNLPVPSPHAFKFSEDNH