TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G7WF32|G7WF32_DESOD Uncharacterized protein OS=Desulfosporosinus orientis (strain ATCC 19365 / DSM 765 / NCIMB 8382 / VKM B-1628) GN=Desor_2034 PE=4 SV=1
MKDSFSRLRSILTFGIAIIFLSNLFVKSDFLQDLNLVMMLVVIFLSFLVVSGTTLIIGSMLFLLSIILFLSYGAPLSIWL
QALQENIYLVVMFALVPLLGIPIRHGGYFEALRGLFQRYVYNDSRFYLLVSFVSAFVGVLVNLAVVPLVLQISQASSKSS
NRKLLSSAIVRGFATCTIWAPTTAAIALVVQLSGASWLTFSPFAVLCGVIAGLTGYFLTMYEEKKAGNDPLAAGEEPAGE
FDPGKVIELSIFSIILIAAIAVLSFVTGIHTIVVVSLASIIYPIAWLGIIGKLQILVREFKIYFNESLPKLQNEIILFMG
AGLFATSISYSHLGSYVSLFLSYVVGNNAFLLAIVIILCILLLSALGVHPIIPVTIVGGTIKAAAYGVTPTYLALVLAIS
WSMGISISPSSATVIALSGLTGQSPIQVGPRWNGRYVLISSGIMLLALTLFRFIGIL