TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8IIS8|G8IIS8_SPOLT Gamma-aminobutyric receptor alpha 2 subunit OS=Spodoptera litura PE=3 SV=1
MHTCRPRGVHSIALVLALAIAWLPHADHAAGAGGGGMFGDVNISAILDSLSVSYDKRVRPNYGGPPVDVGVTMYVLSISS
LSEVKMDFTLDFYFRQFWTDPRLAYKKRTGVETLSVGSEFIRNIWVPDAFFVNEKQSYFHIATTSNEFIRIHHSGSITRS
IRLTITASCPMDLQYFPMDRQLCNIEIESFGYTMRDIRYKWNEGPNSVGVSSEVSLPQFKVLGHRQRAMEISLTTGNYSR
LACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVSLGVTTVLTMTTLMSSTNAALPKISYVKSIDVYLGT
CFVMVFASLLEYATVGYMAKRIQMRKQRFTAVQKMAAEKKMQIDGPPGTSEPLPPPRTSTLTRPPPPSRSSEVRFKVHDP
KAYSKGGTLENTINGSRGPAPAPVPAAPQPDEEAGPPPHLIHASKGINKLLGTTPSDIDKYSRIVFPVCFVCFNLMYWII
YLHVSDVVADDLVLLGEEN