TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8JT79|G8JT79_ERECY Uncharacterized protein OS=Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) GN=Ecym_4155 PE=4 SV=1
MLVDHILAQIPFLLSYPAALLANNLILSPKTPTQDNSIHEYNHDVIPIFMGHLLVPLMTAFMVVSVTQYVLRIFTTNNLL
VFLISFITLVLDSFLGPIQASVLSVNILQVVLASSVSLRYYFVFPVLSLCLNYVDGTSYYATVGSYVSIIAFLVICMKYK
RNSMSYLSQVTIHKYCFPIGILVSLTVTNVWALYVNTVKISHAMVLVFLGCILVALLTYQDMTQDLLCADKDQATMGAVW
KSPYAPAAVGTLAVILQYLSFNNVSATFEGDLVIFAFILASGILPKTIDLSNRHPLKGEDLLDKHCDFQDVRSNLNVRDS
HRGKLMATRSLFKQLAMNKENSAIFSFLLLNFAFMLVQLLYSFRSKSLGLLSDSLHMALDCTSLFLGLVAGVLSKNPPTD
RFPFALTYLETLAGFTNGVLLIGIVSGIFVEAVGRILHPVTLHGTNELIVVSTLGLLVNLIGLFAFDHAGHGHGHDNENL
KGIFLHILADTLGSVGVIVSSLLIKAFGSQIFDPLASIFIASLILLSSIPLIKSTAYGILLKLNDKNHATVKKALNQIVS
TPGITGYTIPRFWPTSLAHIGGHGHAHGHSHGHSHDHSHDHSHEHSNEHSNEHSHKHSHKHSHKHSHEHNNNEEKLHNAS
KKRLIGYIHIQYAEGENSTIIKKRVERIFEKLEIQAWIQVEANDSNCWCRATSMNHRAAFM