TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8YEP6|G8YEP6_PICSO Piso0_002307 protein OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=Piso0_002307 PE=4 SV=1
MSHKRSSWYNGQGYFDPHKEIDKYDLDESTFDLINIENFRNRDKSTVFAYIYTWVMIILSLVLLGTDIYTCLNILVFHRW
STKDFQPYAYSVAKWIFTGCIIFQFVLLAYHWLRAIHTYRTKNIALTYVNTIARLLYIIKSYNYHCLFHQIEQDNFFDWT
CFLCYTELDGAVRLLIADTPRQVINILTLRYYATDRGKSNDIIGNIRTIATTNLRLSIILSFMCLSVAIWSIFFFKFLFG
IVFYIPVMVKLRDRGYKSLKKYCCDVVNDNVRILVRKNHKSKRTLLETGVLDLKDIAANPLLSQSTTTLEDFDFRTLPLG
KEKRKEISKPPATHRIIPQYRYDDNYHSDGGASANSTYESLPLDDMKPEFSYSYTKPRTPKSFIPTSHMNESSNSLNPSL
HNAQTRNYTNPDNRRFMSGRSNTSENISNPFEDEASRVYDPASEPTYMNYSRNSSQLSLVKKDDDETEVKDLSRVSSSVS
LTYSNPFEQESLDKPKPAGADAPPYPVKSLAADEPPYPIRSVSVYDPSISEYNTLEPTRSSSSLTDLHTEFDTLADHSTH
HYHEN