TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8ZSK2|G8ZSK2_TORDC Uncharacterized protein OS=Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) OX=1076872 GN=TDEL0D00120 PE=4 SV=1
MIKPTSTRLVFVLILIVCLSISASRPVADAQPLEKRTNWYYHSISCAAQGLFAYFRVDQPIWFKVQWWGVMTAENGGFID
TADQAWSACNACQRDNKISQGDCRGEVKSLLKMAIMNVVKVTVGWATTSGVNPIMFVDGQNRRKRDLHQRTTTRRCPCLL
TLLCLIVYYLLLK