TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G9MZB0|G9MZB0_HYPVG Uncharacterized protein OS=Hypocrea virens (strain Gv29-8 / FGSC 10586) GN=TRIVIDRAFT_111733 PE=4 SV=1
MATFDPSKPIDDPQVWFPKGMFVDNTAQKLTIKVYDVDTPDDEDKTFILNHDKMVALSRFLWTGKLLPTDRDAYIKTLGL
ITTEEITDEVWTEIDHLLGTYTEISKDCTQFKEVTWDKLVDLSGQIKTYATVAGGTPDSSYYQAVLEWVGEYNTEKNKTN
PDQKTLDDLAAGIKGAIEDEQKKISGIQEHITDAVKALNTFHDNCKGYEKTLEDDGTTLQNLLEKEGNDIEHLSGQISEE
LKEIEDLQTEIDRDHQKIHDTAYYVWIPFIGTIAGITVALIAEADIKRLKESMEKIQAALDANEAKLQTAYALQGDITSM
GTQLTGLVKVIKPAIATLEALQGAWAQMNTDLQTLYDLFEDDKQSVPPMLLLPKELNTIVQAWNDLKDYADDYIQYAFMT
DDPEKVTIQNYVDQLGSQLN