TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G9NAJ2|G9NAJ2_HYPVG Uncharacterized protein OS=Hypocrea virens (strain Gv29-8 / FGSC 10586) GN=TRIVIDRAFT_40035 PE=4 SV=1
MFSLQRLLLHLLFLLATVSATPSQYCLFGLPRDDIDFCMAVSLYHNHSTSAHDVYLSMAVRRSTTSNGTSLGWTAIGTGH
KMAGSLMFVLYGDPEASETKPTLSVRTVKDGHSSPAQVTQQDTGKQLDLRISETSWKKAKDDVYVATASVVCYACSEWMG
AEISPESVSQPWIWAWNKKQDMKTFSPDEQLAIHSVVDGFGYFYVDMKAATSHHADGFPAFNVTGEDSNIGTSNRPIKEE
KTGLWQKLLSRPLAHLHGFFMMTAFLLLFPVGAVAIRSGSEKSFKYHWVIQATAIVSALSGAFVAVAMSDKVFGSPHQIA
GFVIISLLLVQAVLGWRHHVDFIRIFRRTWISYAHISLGFVVLASGWANVITGLVLYGFSKFGIVMVALLILLEAVGVGA
WSYLARRRSLTKGALHKETPESSAAYFALEDIPESDEEDDAAEERGLMQKRND