TCDB is operated by the Saier Lab Bioinformatics Group
>GAV30688.1 hypothetical protein PMKS-004207 [Pichia membranifaciens]
MLFPFKIILFYVTLITVAATPILNKRTFPFYDFIHTVAPIYLRAQFNGNPNVQYWTKIAWWASFVAGDGGLTDNVNVGID
ACQSCIANHQSPNTNCRNDIVSLVKMSITNVTKGVVGWMSGYGANGVDGNGSPVKRQLSNRSGDADIDTFDPVIENWTSN
NITRHLATAHIRSGATMLSKSSINYENGNTVDDFQFNSDDYGLYRVYHSYQGNGNGIVAFSLPNYATNYGNQTLVKRYPT
LDYLCQGYMAVSYCADVNSIARIVDDNNDIESSVSKMYDLATEGSWTSKFFKLYTTNSNDVSESWQASMRVFYIEPNSHP
YETECDTGS