TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H1XWB7|H1XWB7_9BACT Membrane protein involved in aromatic hydrocarbon degradation OS=Caldithrix abyssi DSM 13497 GN=Calab_1070 PE=4 SV=1
MKRIVALILFFTVNVFAQTVEEATLLVENESGFGVKAAALGNAFTAIADDYSAIYWNPAGLAQIKMQQMYGSLNHLKLNT
ETTFLGNKTTLDQGYTKFQSFGYVYPFPVRRGSMVLALGYQRTKDLNKIVQFSGFNPNSNDLAFSIYNDLGYDGLILPFD
ADLNLSQNIKEDGHLSQWSIGGAIDLAPNFSAGATVNFIGGSSDYRLKYLQEDARGTNSYDIYDADGQLIENFYYNYYQI
EQLISTDYSGIELKLGGLWRLNQNLRVGANITFPMKLSVDETWTYADELSYDVYVIGEDATYRFVEPYDSLGQFNYNIKV
PFKFDLGFSYTFKNLLLAASGRYVDWTQLELEKGDDAPAGYETYFTRQNDMAPLILTDVFSYSLGAQLSILNNSLQLRAG
YRYVPSPIKDSEKSFDKTYVSVGAGFIISKNTQIDVAVIRGIYETDKYYRYDWDYDQSLEPMATHEKYQIDRIQVGLRYS
F