TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H2ETP6|H2ETP6_9EURO Natural resistance-associated macrophage protein OS=Exophiala pisciphila PE=2 SV=1
MNCPSRPDNIEGHPDWNQNPHDLSSDLTTRADLNGIVNLREQRENDSSLTNDQQEQINVVPADNTESPVAGLKSPPNVKV
DPMKQAKTATSAFQPQAARPPMKSRSLSPVLVLNKVITTLRKYVKFVGPGFLIAVAYIDPGNYATDVEAGAATQYRHLFI
ILMSNLFAIFLQSLCIKLGSVTGLNLAENCRKHLPRWLTIILYIFAESAIIATDIAEVIGSAIALNLLFKIPLVAGCAIT
LVDVLVLLLFYRPDGSMVRLRLFEYFVMSLVLGVMVCFCIQLTYIQGTTPGEVFKGYLPSSAIVEGNGIYLSCGIIGATV
MPHSIFLGSGVVQPRLKQFDQQNGHISLAEDSDDEVEKYVPSIYAIKACLKYSVVELATSLFTFALFINSAILIVSGASL
YPKTEATDADLFGIYDLLSENLSKVAGTLFAIALLLSGTSAGIVCTMAGQMVSEGMLHWTLRPWLRRLITRAISIIPSII
IAAAIGREGLNQALTASQVCLSVILPFVTAPLIWFTCRSHIMTVRTVQGEQSGQDVNMRNNWLTAALATVIWLVLVVMNV
ALLVLVGLGKA