TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H2G2H8|H2G2H8_CORD3 Integral membrane protein OS=Corynebacterium diphtheriae (strain 31A) GN=CD31A_1052 PE=4 SV=1
MITSDQSNASQFDDHRRPLLRALKFGTIALVAITLISLVLWGRFRDLPGIWGVVLGAAVGGGFVLLTVVSVLVTSNTSAA
TTGAVVLGGWLLKLVALLIVLIILRGMDFYDPVAFVVTTIIALVVVLGTEVWGVITSRVTYVSPGNI