TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H2J8A7|H2J8A7_MARPK Uncharacterized protein OS=Marinitoga piezophila (strain DSM 14283 / JCM 11233 / KA3) GN=Marpi_1182 PE=4 SV=1
MKLRNLIFKIGIFFIAFDNLFFAPSNGWAAISPIIFFIYIILDYKSLVISLFNNLKIFSIIYFMILYTFLNDIFYNVDVG
NLLDSIISLILGFAFYLSLYDRYILKKYSLKRDLKILIMGYSFSLMYGILKYIALRFQIIYIIKFQEIFEKRYYPRVSFG
FTEPSFISPHVFGILLILFFSLDGKYYKNEKKRILYLISFYVIITFVSKSSTRFFVDLFFISIILLITKINIKKSYNIIL
MFIFLALIMFFYSDLENVLTYNLRIKKIIDYGIYADASLASRYFRINSSIKGYLQDPLIALIGKGTGNSSYFLKKGYLGA
YQEYKNEYLNEILALKYRNPNQLFSMPIRLISEFGIIFFLILFFNLFVKSLKSRKITIFLIMSYIYIQFDSYAFYSFWIY
LFILKYDKFFNKQKIECKF