TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H2JXL4|H2JXL4_STRHJ ABC transporter substrate-binding protein OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008) GN=SHJG_6735 PE=4 SV=1
MHNKTFVAVAVGLGLIGLSACGSGKSEPAADSKTVTLVSHDSWAVSKNVLKDFEKQSGYKVRVLKDGDAGQAVNKAVLTK
DNPQGDVFFGVDNTLLSRALDNGLFQPYQAKGYDTVRPEFRVDQDKHRVTPVDTGDICVNYDKAWFSAHKLTPPQSFADL
AEPAYKNLLVTENAATSSPGLGFLLGSAARFGDGGWQGYWKKLKANGVKVVDGWEQAYYQEFSGSSEGRKAGGDRPLVVS
YASSPPAEVIYAKKRPSTAPTGVSYGTCFRQTEYAGLLSNAKNTKGGKAFLDFLLTREFQQDMPLNMFVYPVVEGAAVPA
DFTKYGPAAKDPETMAPDKIAANRDQWVKSWTSLVLK