TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H2RT55|H2RT55_TAKRU Uncharacterized protein OS=Takifugu rubripes PE=4 SV=1
MEAISQENEEEENDVVEVRYKLTLIGSLSVHYLTTMAMLPWVVAEISKAQDSEKKPAEHGPSPQIVFLCVSVSWVRCVSI
LGEELLWDPLTHRLLFECLPHQVTKLIHNSQEPSSFGCLVRDSANCACYVFRCQDSSKVPEIISVLRKAGKSSARNDNVD
SDLLFSTNFAKRFEVLFCGRVTVPHKNAPPALIDECIVKFSQLQNSVVSLREGDTLGSPTTGKHPVLFKRAPSFPCLQAL
DENGLSPEICQAITTESHLHLTGVQPTSQQQNSNMLFMVTGSQILLVSPETKKTSMEKSFREISFCSQGIHHVDHFGFIC
RETAEEGNCHFVCYVFQCASESLVDEIMLTLKQAFSRAVEWKKSNPQWQQCDACPLMQFHRLCERIEGLSPFDTKLELQK
HSASLDNQEQASVFEVAMRSCPKSDKEENELVMASLRRLYEKKQSNHQHSVTQNSEEKAAPTNLEAHHSSSQQKLGQLKS
RAKRSLTESLEGIWKGGNRARTQTNLSSGSGSGASFDTVYSSQEQPCFDDPLPASNSPLRPQWSSGDLKHLDPPSALATY
TFSKQGDAELQGVRRRANTFSHSPTPQSAEHSLEYTLKTQKVAASDTSKLSRHYSLSSDTPHQSNAAAALSHPSSTFEMD
ESPLRSHSHSWRQQIFLRVATPQKSTENIVEMQQYFSVGHLKSNGSFKHFKYCVNTPDGRQEKKLNRSKDELRELWRTAI
KQQILLQRMEKENLKLKASENNLQNKRLKLDYDEITPCLKEVTLVWEKMLATPDRPKVKVDMEIIHAALAQGVPKQHRGE
VWKFLSEQHLLRQTVSSQPPPDNTAYKELLKQVSSEQHAILIDLGRTFPTHPYFEESMGPGQLSLYNVLSAYSVLDPEVG
YCQGLCFVTGVLLLHLEEEDAFNMLKFLMFVLGLRQQYKPSMTAVQIQMYQLSRLLHDYHKDLQCHLEQQDIAPSLYAPP
WFLTNFASQYPLGFVARVFDMLFLQGPEVIFKVGLSLLGSHKLLIMQHDSLESIVDVIKTELPNLGLVQMEKTVNQVCEM
DLTKQLQAYEVEYQVLNDELHAPSDQRSAHLEKVYQSLQQQNSELMEELQVSHVRVSSLEQQLESLVQSERLLKEQVSTL
ELEKNQLVDTVARLQQ