TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H5TII5|H5TII5_9ACTO Putative uncharacterized protein OS=Gordonia otitidis NBRC 100426 GN=GOOTI_060_00050 PE=4 SV=1
MSGNESGRSDYRNAGGKTPSIPLSDADRDSSGEASVGSLVKNATASVSTLFRSEVALAKAELVDDAKKAGTGTGLLIVAG
VMALYASFFFFFFLAELLDEWVPRWAAFLIVFGILVLITLIAAFVGYVVFKKVRGPKKTINSVKEVQTVLPGRHEAGAAQ
DGSHPAIPPAREA