TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H8ZJB9|H8ZJB9_9PHYC Putative uncharacterized protein OS=Ostreococcus tauri virus RT-2011 GN=OtV6_122c PE=4 SV=1
MLPDITSQKVAVPAALFLALSPGVLLTTNGQKLAFRNGKTNQMAVFFHALVFFLVYSLIARAMGLVLTKTDLIVTTVLFL
ALSPGLLLTLPPGSGGVLRSGQTSIPAAVTHAVVFAVVFALLRKQFPQFY